No.8 Jinshun Road Zhuqiao Pudong New District,Shanghai,China
Home ProductsInjectable Peptides

Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders

Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders

  • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
  • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
  • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
  • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
  • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
  • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
Product Details:
Place of Origin: ShangHai
Brand Name: FILTER
Certification: GMP
Model Number: API
Payment & Shipping Terms:
Minimum Order Quantity: 10 vials
Price: USD 4~8 per vial
Packaging Details: 2mg,5mg/vial, 10mg/vial or as required
Delivery Time: Within 3 working days
Payment Terms: L/C, T/T, , MoneyGram,Payneer
Supply Ability: 100,000vials/month
Contact Now
Detailed Product Description
Specification: 2mg/vial Appearance: White Powder
DeliveryTime: Within 3~7 Working Days Port: Shanghai / Shenzhen/ Hongkong
PackAge: Icebag, Discreet Packing Ways For Your Reference LimitNum: 10 Vials
Purity: 99% Transportation: DHL, Fedix, HKEMS, HKEUB, TNT
Storage: Dry, Dark And Ventilated Place,(2~8 Dogree)
High Light:

peptides bodybuilding supplements

,

human growth peptides

CJC-1295 with DAC

Product Name:CJC1295 DAC;CJC1295 with DAC
Alias: CJC1295(GHRH/DAC)
Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-LysLys(Maleimidopropionyl)-NH2 (Affinity Complex)
Density:1.45
CJC-1295 with DAC
Type: Immune Function AgentsGrade
Standard: Medicine Grade
Classification: Brassinosteroid
MF: C165H271N47O46
Molecular Weight: 3649.30
Purity (HPLC): 98.0%
Appearance: White powder
Single Impurity(HPLC): 1.0%
Amino Acid Composition: 10% of theoretical
Peptide Content(N%): 80%(by %N)
Water Content(Karl Fischer): 6.0%
Acetate Content(HPIC): 15.0%
Mass Balance: 95.0~105.0%

Filter Bio-Tech Co.,Ltd. Business Field:

As Peptides and Steroids manufacturer,we are for OEM for clients who have Brands Requirements.(Custom-made Service).
Our Company Services:

  1. Pharmaceutical Peptide+Bodubuilding Peptide
  2. Cosmetic Peptide
  3. Sterodis Powder,Oil and Tabs
  4. Custom-made Service

Which one types your clients prefer?

 

Description
Product Name: CJC1295
Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 Acetate;CJC1295 with out DAC
CAS: 863288-34-0
MF: C159H258N46O45
MW: 0
EINECS:  
Product Categories: Peptides


Our process:
The quality control process
1) Purchasing
Thorough market research, understand the price of raw materials and performance.To the procurement source to understand fully, and fully guarantee the quality of the procurement of raw materials.


2) Inspection
Four steps: sampling, sample pretreatment, measuring and data processing.


3) Producing
a) Each operator must do self-inspection of producs and make the corresponding inspection records.
b) Full-time inspectors through check the operator self-inspection, and review and sign in the corresponding record. Full-time inspection is responsible for inspection of finished product, and make the finished product incoming inspection records.


4) Before selling
Test result can be provided before selling.
Third-party detection institution is allowed if you are not satisfied with test results.


Our advantages:
1. Quality:
Our company is a professional production of hormone intermediates for many years, our products have exported to Germany,Spain, UK, USA, Australia, Middle East, and so on other country, and we have got very good feedback from our customers, you can trust us.
And we are the manufactory, so no problem for us to control the quality.
2. Payment method: ,TT.
3. Service: Best service with after-sales service to all clients.
4. Delivery:
Sample Order :Package will be shipped with 3days after payment. We can send it via UP, EMS, HK Air Post, DHL or othermethod. We have a professional and stable logistics, and we can deliver the package smoothly around 3 to 5 days.


Other Peptide Our Lab Supply:

Product Purity CAS No.
Glucagon Hydrochloride 98% 16941-32-5
Gonadorelin Acetate 98% 34973-08-5
Goserelin Acetate 98% 145781-92-6
GRF (human) Acetate 98% 83930-13-6
Hexarelin Acetate 98% 140703-51-1
Histrelin Acetate 98% 76712-82-8
Icatibant Acetate 98% 30308-48-4
Lanreotide 98% 108736-35-2
Lecirelin (Dalmarelin) Acetate 98% 61012-19-9
Leuprolide 98% 74381-53-6
Leuprorelin Acetate 98% 53714-56-0
Linaclotide Acatate 98% 851199-59-2
Lixisenatide 98% 320367-13-3
Lraglutide 98% 204656-20-2
Lysipressin Acetate 98% 50-57-7
Melanotan II Acetate 98% 121062-08-6
MOG(35-55) 98% 163913-87-9
Nafarelin Acetate 98% 76932-56-4
Nesiritide Acetate (BNP-32) 98% 114471-18-0
Octreotide 98% 79517-01-4
Ornipressin Acetate 98% 3397-23-7
Oxytocin Acetate 98% 50-56-6
Palmitoyl Pentapeptide 98% 214047-00-4
Pexiganan 98% 147664-63-9
Pramlintide Acetate 98% 196078-30-5
Pretirelin    
PT141 Acetate 98% 32780-32-8
Salmon Calcitonin Acetate 98% 47931-85-1
Secretin Acetate 98% 10813-74-8
Sermorelin Acetate 98% 86168-78-7
Sincalide 98% 25126-32-3
Somatostatin Acetate 98% 38916-34-6
Splenopentin Acetate 98% 105184-37-0
Taltirelin Acetate 98% 103300-74-9
Teriparatide Acetate 98% 52232-67-4
Teriparatide Acetate 98% 52232-67-4
Terlipressin Acetate 98% 14636-12-5
Tetracosactide Acetate 98% 16960-16-0
Thymalfasin 98% 62304-98-7
Thymopentin 98% 69558-55-0
Thymosin α1 Acetate 98% 14636-12-5
Thymosin β4 Acetate(TB-500) 98% 77591-33-4
Triptorelin Acetate 98% 57773-63-4
Vapreotide Acetate 98% 103222-11-3
Vasopressin Acetate 98% 9034-50-8
Ziconotide Acetate 98% 107452-89-1

 

Lab

Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders 0

VIP Clients Policy:
If your Purchasing Total Amount in our company per year could reach 50,000 USD,at the end of year ,we could use 2%-5% of the Total Amount to send Free goods.

Customer Types which had more support:
1.Potential customer
(With Purchasing Data +Clients'Current Market Clients Number and Products Quantity per month to apply)

2.Stable customer group and stable Quantity Order per month
(With complete Purchasing Data with our company to Apply)

3.Regular Personal Users
(With complete Purchasing Data with our company to Apply)

4.Clients who have funds and have plan to expand market
(With Purchasing Data +Clients'Current Market Clients Number and Products Quantity per month to apply)
**Current Real Data+Future Market(Based on Current)

 

Contact Details
Passion Technology Development Limited

Contact Person: Qin

Send your inquiry directly to us (0 / 3000)

Other Products
Request A Quote

E-Mail | Sitemap

Privacy Policy | China Good Quality Injectable Peptides Supplier. © 2018 - 2023 peptide-steroids.com. All Rights Reserved.