Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders

Product Details:

Place of Origin:	ShangHai
Brand Name:	FILTER
Certification:	GMP
Model Number:	API

Payment & Shipping Terms:

Minimum Order Quantity:	10 vials
Price:	USD 4~8 per vial
Packaging Details:	2mg,5mg/vial, 10mg/vial or as required
Delivery Time:	Within 3 working days
Payment Terms:	L/C, T/T, , MoneyGram,Payneer
Supply Ability:	100,000vials/month

Contact Now

Detailed Product Description

Specification:	2mg/vial	Appearance:	White Powder
DeliveryTime:	Within 3~7 Working Days	Port:	Shanghai / Shenzhen/ Hongkong
PackAge:	Icebag, Discreet Packing Ways For Your Reference	LimitNum:	10 Vials
Purity:	99%	Transportation:	DHL, Fedix, HKEMS, HKEUB, TNT
Storage:	Dry, Dark And Ventilated Place,(2~8 Dogree)
High Light:	peptides bodybuilding supplements , human growth peptides

CJC-1295 with DAC

Name: Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
Brand: FILTER
SKU: API
Price: 4 USD
Availability: InStock
Rating: 4.9 (160 reviews)

Product Name:CJC1295 DAC;CJC1295 with DAC
Alias: CJC1295(GHRH/DAC)
Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-LysLys(Maleimidopropionyl)-NH2 (Affinity Complex)
Density:1.45
CJC-1295 with DAC
Type: Immune Function AgentsGrade
Standard: Medicine Grade
Classification: Brassinosteroid
MF: C165H271N47O46
Molecular Weight: 3649.30
Purity (HPLC): 98.0%
Appearance: White powder
Single Impurity(HPLC): 1.0%
Amino Acid Composition: 10% of theoretical
Peptide Content(N%): 80%(by %N)
Water Content(Karl Fischer): 6.0%
Acetate Content(HPIC): 15.0%
Mass Balance: 95.0~105.0%

Filter Bio-Tech Co.,Ltd. Business Field:

As Peptides and Steroids manufacturer,we are for OEM for clients who have Brands Requirements.(Custom-made Service).
Our Company Services:

Pharmaceutical Peptide+Bodubuilding Peptide
Cosmetic Peptide
Sterodis Powder,Oil and Tabs
Custom-made Service

Which one types your clients prefer?

Description

Product Name:	CJC1295
Synonyms:	CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 Acetate;CJC1295 with out DAC
CAS:	863288-34-0
MF:	C159H258N46O45
MW:	0
EINECS:
Product Categories:	Peptides

Our process:
The quality control process
1) Purchasing
Thorough market research, understand the price of raw materials and performance.To the procurement source to understand fully, and fully guarantee the quality of the procurement of raw materials.

2) Inspection
Four steps: sampling, sample pretreatment, measuring and data processing.

3) Producing
a) Each operator must do self-inspection of producs and make the corresponding inspection records.
b) Full-time inspectors through check the operator self-inspection, and review and sign in the corresponding record. Full-time inspection is responsible for inspection of finished product, and make the finished product incoming inspection records.

4) Before selling
Test result can be provided before selling.
Third-party detection institution is allowed if you are not satisfied with test results.

Our advantages:
1. Quality:
Our company is a professional production of hormone intermediates for many years, our products have exported to Germany,Spain, UK, USA, Australia, Middle East, and so on other country, and we have got very good feedback from our customers, you can trust us.
And we are the manufactory, so no problem for us to control the quality.
2. Payment method: ,TT.
3. Service: Best service with after-sales service to all clients.
4. Delivery:
Sample Order :Package will be shipped with 3days after payment. We can send it via UP, EMS, HK Air Post, DHL or othermethod. We have a professional and stable logistics, and we can deliver the package smoothly around 3 to 5 days.

Other Peptide Our Lab Supply:

Product	Purity	CAS No.
Glucagon Hydrochloride	98%	16941-32-5
Gonadorelin Acetate	98%	34973-08-5
Goserelin Acetate	98%	145781-92-6
GRF (human) Acetate	98%	83930-13-6
Hexarelin Acetate	98%	140703-51-1
Histrelin Acetate	98%	76712-82-8
Icatibant Acetate	98%	30308-48-4
Lanreotide	98%	108736-35-2
Lecirelin (Dalmarelin) Acetate	98%	61012-19-9
Leuprolide	98%	74381-53-6
Leuprorelin Acetate	98%	53714-56-0
Linaclotide Acatate	98%	851199-59-2
Lixisenatide	98%	320367-13-3
Lraglutide	98%	204656-20-2
Lysipressin Acetate	98%	50-57-7
Melanotan II Acetate	98%	121062-08-6
MOG(35-55)	98%	163913-87-9
Nafarelin Acetate	98%	76932-56-4
Nesiritide Acetate (BNP-32)	98%	114471-18-0
Octreotide	98%	79517-01-4
Ornipressin Acetate	98%	3397-23-7
Oxytocin Acetate	98%	50-56-6
Palmitoyl Pentapeptide	98%	214047-00-4
Pexiganan	98%	147664-63-9
Pramlintide Acetate	98%	196078-30-5
Pretirelin
PT141 Acetate	98%	32780-32-8
Salmon Calcitonin Acetate	98%	47931-85-1
Secretin Acetate	98%	10813-74-8
Sermorelin Acetate	98%	86168-78-7
Sincalide	98%	25126-32-3
Somatostatin Acetate	98%	38916-34-6
Splenopentin Acetate	98%	105184-37-0
Taltirelin Acetate	98%	103300-74-9
Teriparatide Acetate	98%	52232-67-4
Teriparatide Acetate	98%	52232-67-4
Terlipressin Acetate	98%	14636-12-5
Tetracosactide Acetate	98%	16960-16-0
Thymalfasin	98%	62304-98-7
Thymopentin	98%	69558-55-0
Thymosin α1 Acetate	98%	14636-12-5
Thymosin β4 Acetate(TB-500)	98%	77591-33-4
Triptorelin Acetate	98%	57773-63-4
Vapreotide Acetate	98%	103222-11-3
Vasopressin Acetate	98%	9034-50-8
Ziconotide Acetate	98%	107452-89-1

Lab

VIP Clients Policy:
If your Purchasing Total Amount in our company per year could reach 50,000 USD,at the end of year ,we could use 2%-5% of the Total Amount to send Free goods.

Customer Types which had more support:
1.Potential customer
(With Purchasing Data +Clients'Current Market Clients Number and Products Quantity per month to apply)

2.Stable customer group and stable Quantity Order per month
(With complete Purchasing Data with our company to Apply)

3.Regular Personal Users
(With complete Purchasing Data with our company to Apply)

4.Clients who have funds and have plan to expand market
(With Purchasing Data +Clients'Current Market Clients Number and Products Quantity per month to apply)
**Current Real Data+Future Market(Based on Current)