No.8 Jinshun Road Zhuqiao Pudong New District,Shanghai,China
Home ProductsInjectable Peptides

Pharmaceutical Grade 99% Purity Injectable Peptides CJC1295 Cas 863288-34-0

Pharmaceutical Grade 99% Purity Injectable Peptides CJC1295 Cas 863288-34-0

    • Pharmaceutical Grade 99% Purity Injectable Peptides CJC1295 Cas 863288-34-0
    • Pharmaceutical Grade 99% Purity Injectable Peptides CJC1295 Cas 863288-34-0
    • Pharmaceutical Grade 99% Purity Injectable Peptides CJC1295 Cas 863288-34-0
    • Pharmaceutical Grade 99% Purity Injectable Peptides CJC1295 Cas 863288-34-0
  • Pharmaceutical Grade 99% Purity Injectable Peptides CJC1295 Cas 863288-34-0

    Product Details:

    Place of Origin: China
    Brand Name: FILTER

    Payment & Shipping Terms:

    Minimum Order Quantity: 10 vials
    Packaging Details: 5mg/vial, 10mg/vial or as required
    Delivery Time: Within 7 working days
    Payment Terms: L/C, T/T, , MoneyGram,Alipay
    Supply Ability: 100000vials/month
    Contact Now
    Detailed Product Description
    Specification: 2mg/vial Appearance: White Powder
    DeliveryTime: Within 7 Working Days Port: Shanghai / Guangzhou / Hongkong/
    PackAge: Icebag, Discreet Packing Ways For Your Reference LimitNum: 10 Vials
    Purity: 99% Transportation: DHL, Fedix, HKEMS, HKEUB, TNT
    Storage: Dry, Dark And Ventilated Place
    High Light:

    peptide supplements

    ,

    human growth peptides

    Pharmaceutical Intermediate Peptide Lab Supply Cjc-1295 With Dac 863288-34-0

    Description
    Product Name: CJC1295
    Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 Acetate;CJC1295 with out DAC
    CAS: 863288-34-0
    MF: C159H258N46O45
    MW: 0
    EINECS:  
    Product Categories: Peptides
     

    Specification
    Name: Modified GRF (1-29)
    Synonyms: (CJC-1295 no DAC)
    Molecular Formula: C152H252N44O42
    Molecular Mass: 3368.7 Da (g/mol)
    Amino Acid Sequence: Tyr-DAla-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2

     

    Purity
    CJC-1295 has a peptide purity level that exceeds 99.0% as determined by HPLC and MS.

    Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin
    CAS NO.: 863288-34-0
    Molecular Formula: C152H252N44O42
    Molecular weight: 3367.2
    Molar Mass: 3368.7
    Peptide purity: > 98.0%
    Appearance: White lyophilized powder
    Related substance: Total Impurities (%) ≤ 2.0%
    Acetate content: ≤ 15.0%
    Bacterial Endotoxins: ≤5 IU/mg
    Sequence: Tyr-d-ALA-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
    Source: Chemical Synthesis
    Reconstitution: To follow best practice guidelines for reconstituting CJC-1295 without DAC, reconstitute in sterile, bacteriostatic, distilled water, with light sonication if necessary.
    Shelf life: One year from dispatch.

    Storage for CJC-1295 without DAC

    Lyophilized MOD GRF 1-29 is stable at room temperature for 90 days, however it should be stored in a freezer below -8°C for any extended period of time. After reconstitution, may be stored for a maximum of 14 days in a refrigerator at 2°C - 8°C. Store vials in an upright position. Store MOD GRF-129 refrigerated between temperatures 2°C - 8°C. Keep in the outer carton in order to protect from light. For one month can be stored at room temperature.

     

    Function & Usage

    Modified GRF 1-29 is also known as Mod GRF 1-29, but even more commonly known as CJC-1295 without DAC. It is a protein that is 29 amino acids long and it is a GHRH analogue. CJC-1295 without DAC acts on receptors at the pituitary gland to stimulate the release of Human Growth Hormone.

    CJC-1295 without DAC could be referred to more properly as a second generation derivative of GHRH. GHRH is modified to create what is known as Releasing Factor (GRF) 1-29, also known as Sermorelin. GRF 1-29 is then further modified to create Mod GRF 1-29 which is CJC-1295 without DAC.

    CJC-1295 without DAC Dosage

    Mod GRF 1-29 is typically provided in vials containing 2 mg of lyophylized powder, though the amount can vary. The contents should be reconstituted by adding a convenient amount of sterile or bacteriostatic water. If for example 2 mL is chosen and the dosing of the vial is 2 mg, the resulting solution then has a concentration of 1 mg/mL, or 1000 mcg/mL.

    At time of dosing, an insulin syringe is used to draw and then inject the desired amount. In the above example, a 100 mcg dose would require a volume of 0.10 mL, or "10 IU" as marked on an insulin syringe.
    Injection may be subcutaneous, intramuscular, or intravenous, according to personal preference. If desired, peptide solutions from other vials, such as a vial of a GHRP product, may also be drawn into the same syringe. This reduces the total number of injections required.Pharmaceutical Grade 99% Purity Injectable Peptides CJC1295 Cas 863288-34-0 0

     

    Pharmaceutical Grade 99% Purity Injectable Peptides CJC1295 Cas 863288-34-0 1
     

    Contact Details
    Passion Technology Development Limited

    Contact Person: Qin

    Send your inquiry directly to us (0 / 3000)

    Other Products
    Request A Quote

    E-Mail | Sitemap

    Privacy Policy China Good Quality Injectable Peptides Supplier. © 2018 - 2021 peptide-steroids.com. All Rights Reserved.