No.8 Jinshun Road Zhuqiao Pudong New District,Shanghai,China
Home ProductsInjectable Peptides

High Quality 2/5/10mg/Vial Bodybuilding Peptide Cjc-1295 with Dac for Muscle Enhance

High Quality 2/5/10mg/Vial Bodybuilding Peptide Cjc-1295 with Dac for Muscle Enhance

  • High Quality 2/5/10mg/Vial Bodybuilding Peptide Cjc-1295 with Dac for Muscle Enhance
  • High Quality 2/5/10mg/Vial Bodybuilding Peptide Cjc-1295 with Dac for Muscle Enhance
  • High Quality 2/5/10mg/Vial Bodybuilding Peptide Cjc-1295 with Dac for Muscle Enhance
High Quality 2/5/10mg/Vial Bodybuilding Peptide Cjc-1295 with Dac for Muscle Enhance
Product Details:
Place of Origin: China
Brand Name: FILTER
Payment & Shipping Terms:
Minimum Order Quantity: 10 vials
Packaging Details: 5mg/vial, 10mg/vial or as required
Delivery Time: Within 7 working days
Payment Terms: L/C, T/T, , MoneyGram,Alipay
Supply Ability: 100000vials/month
Contact Now
Detailed Product Description
Specification: 2mg/vial Appearance: White Powder
DeliveryTime: Within 7 Working Days Port: Shanghai / Guangzhou / Hongkong/
PackAge: Icebag, Discreet Packing Ways For Your Reference LimitNum: 10 Vials
Purity: 99% Transportation: DHL, Fedix, HKEMS, HKEUB, TNT
Storage: Dry, Dark And Ventilated Place
High Light:

peptide supplements


human growth peptides

2/5/10mg/Vial Bodybuilding Peptide Cjc-1295 with Dac CAS 863288-34-0

Product Name: CJC1295
Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 Acetate;CJC1295 with out DAC
CAS: 863288-34-0
MF: C159H258N46O45
MW: 0
Product Categories: Peptides


What should be noticed?
1.Since CJC-1295 is just a peptide and not a steroid, it has very minimal side effects. People using high doses of this peptide can experience mild side effects like long dreams that they can remember clearly, hands and fingers going numb, dull aches in the joints, and weakness as well as lightheadedness if enough carbohydrates are not consumed.
2.Another side effect of the CJC-1295 is acromegaly, since it helps in increasing the levels of the hormone. Acromegaly is a condition where extra growth hormone is released even after the internal organs and the skeleton have finished growing. This causes thickening of the skin, deepening of voice, enlargement of jaws, and slurring of speech. Another effect of acromegaly is the swelling of the soft tissue in the internal organs. This could result in the weakening of the muscles of the internal organs, like the heart. This was tested during the phase 2 testing of CJC-1295.

Our process:
The quality control process
1) Purchasing
Thorough market research, understand the price of raw materials and performance.To the procurement source to understand fully, and fully guarantee the quality of the procurement of raw materials.
2) Inspection
Four steps: sampling, sample pretreatment, measuring and data processing.
3) Producing
a) Each operator must do self-inspection of producs and make the corresponding inspection records.
b) Full-time inspectors through check the operator self-inspection, and review and sign in the corresponding record. Full-time inspection is responsible for inspection of finished product, and make the finished product incoming inspection records.
4) Before selling
Test result can be provided before selling.
Third-party detection institution is allowed if you are not satisfied with test results.
Our advantages:
1. Quality:
Our company is a professional production of hormone intermediates for many years, our products have exported to Germany,Spain, UK, USA, Australia, Middle East, and so on other country, and we have got very good feedback from our customers, you can trust us.
And we are the manufactory, so no problem for us to control the quality.
2. Payment method: ,TT.
3. Service: Best service with after-sales service to all clients.
4. Delivery:
Sample Order :Package will be shipped with 3days after payment. We can send it via UP, EMS, HK Air Post, DHL or othermethod. We have a professional and stable logistics, and we can deliver the package smoothly around 3 to 5 days.
Other Peptide Our Lab Supply:

High Quality 2/5/10mg/Vial Bodybuilding Peptide Cjc-1295 with Dac for Muscle Enhance 0


High Quality 2/5/10mg/Vial Bodybuilding Peptide Cjc-1295 with Dac for Muscle Enhance 1

Contact Details
Passion Technology Development Limited

Contact Person: Qin

Send your inquiry directly to us (0 / 3000)

Other Products
Request A Quote

E-Mail | Sitemap

Privacy Policy | China Good Quality Injectable Peptides Supplier. © 2018 - 2022 All Rights Reserved.